Product: Lurasidone (D10 Hydrochloride)
CSAD Antibody Summary
| Immunogen |
This antibody was developed against Recombinant Protein corresponding to amino acids:FGVVVDEAIQKGTSVSQKVCEWKEPEELKQLLDLELRSQGESQKQILERCRAVIRYSVK
|
| Specificity |
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
|
| Isotype |
IgG
|
| Clonality |
Polyclonal
|
| Host |
Rabbit
|
| Gene |
CSAD
|
| Purity |
Immunogen affinity purified
|
| Innovators Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovators Reward
|
Applications/Dilutions
| Dilutions |
|
||
| Application Notes |
For HIER pH6 retrieval is recommended.
|
||
| Control Peptide |
|
Reactivity Notes
Expected species cross reactivity based on sequence homology: Mouse (85%), Rat (83%)
Packaging, Storage & Formulations
| Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
|
| Buffer |
PBS (pH 7.2) and 40% Glycerol
|
| Preservative |
0.02% Sodium Azide
|
| Purity |
Immunogen affinity purified
|
Alternate Names for CSAD Antibody
- CSDMGC119355
- cysteine sulfinic acid decarboxylase
- Cysteine-sulfinate decarboxylase
- EC 4.1.1
- EC 4.1.1.29
- FLJ44987
- FLJ45500
- MGC119354
- MGC119357
- PCAP
- P-selectin cytoplasmic tail-associated protein
- Sulfinoalanine decarboxylase