Product: Allopregnanolone
GPR75 Antibody Summary
| Immunogen |
Synthetic 19 amino acid peptide from C-terminus of human GPR75.
|
| Specificity |
Human GPR75. BLAST analysis of the peptide immunogen showed no homology with other human proteins.
|
| Predicted Species |
Mouse (95%), Rat (95%), Hamster (95%), Turkey (95%). Backed by our 100% Guarantee.
|
| Clonality |
Polyclonal
|
| Host |
Rabbit
|
| Gene |
GPR75
|
| Purity |
Immunogen affinity purified
|
| Innovators Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovators Reward
|
Applications/Dilutions
| Dilutions |
- Immunohistochemistry-Paraffin 10 – 25 ug/ml
|
| Positive Control |
| GPR75 Lysate (NBL1-11291) |
|
|
Reactivity Notes
Gorilla. Predicted cross-reactivity based on sequence identity: Elephant (100%), Panda (95%), Opossum (89%), Chicken (89%), Lizard (89%), Xenopus (89%), Zebrafish (84%).
Packaging, Storage & Formulations
| Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
|
| Buffer |
PBS
|
| Preservative |
0.1% Sodium Azide
|
| Concentration |
1.0 mg/ml
|
| Purity |
Immunogen affinity purified
|
Alternate Names for GPR75 Antibody
Background
GPR75 is an Orphan-A GPCR with an unknown ligand. G protein-coupled receptor GPR75 has been reported to be expressed in brain and eye. ESTs have been isolated from human brain, eye, nerve, skin, and stomach libraries.
PMID: 2843633
Product: ICI 118,551 (hydrochloride)
GPR75 Antibody Summary
| Immunogen |
Synthetic peptides corresponding to GPR75(G protein-coupled receptor 75) The peptide sequence was selected from the middle region of GPR75.Peptide sequence GQSSSTPINTRIEPYYSIYNSSPSQEESSPCNLQPVNSFGFANSYIAMHY.
|
| Clonality |
Polyclonal
|
| Host |
Rabbit
|
| Gene |
GPR75
|
| Purity |
Immunogen affinity purified
|
| Innovators Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovators Reward
|
Applications/Dilutions
| Dilutions |
- Western Blot 1:100-1:2000
|
| Application Notes |
This is a rabbit polyclonal antibody against GPR75 and was validated on Western blot.
|
Packaging, Storage & Formulations
| Storage |
Store at -20C. Avoid freeze-thaw cycles.
|
| Buffer |
PBS & 2% Sucrose.
|
| Preservative |
No Preservative
|
| Purity |
Immunogen affinity purified
|
Notes
The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
Alternate Names for GPR75 Antibody
Background
GPR75 is a member of the G protein-coupled receptor family. GPRs are cell surface receptors that activate guanine-nucleotide binding proteins upon the binding of a ligand.GPR75 is a member of the G protein-coupled receptor family. GPRs are cell surface receptors that activate guanine-nucleotide binding proteins upon the binding of a ligand.[supplied by OMIM]. PRIMARYREFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-1894 AK314885.1 1-1894 1895-2115 AF072693.1 1834-2054
PMID: 17211407