Integrin alpha 2b/CD41 Antibody Summary
| Immunogen |
This antibody was developed against Recombinant Protein corresponding to amino acids:CVPQLQLTASVTGSPLLVGADNVLELQMDAANEGEGAYEAELAVHLPQGAHYMRALSNVEGFERLICNQKKENETRV
|
| Specificity |
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
|
| Isotype |
IgG
|
| Clonality |
Polyclonal
|
| Host |
Rabbit
|
| Gene |
ITGA2B
|
| Purity |
Immunogen affinity purified
|
| Innovators Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovators Reward
|
Applications/Dilutions
| Dilutions |
|
||
| Application Notes |
For IHC-Paraffin HIER pH 6 retrieval is recommended.
|
||
| Control Peptide |
|
Reactivity Notes
Expected species cross reactivity based on sequence homology: Mouse (81%)
Packaging, Storage & Formulations
| Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
|
| Buffer |
PBS (pH 7.2) and 40% Glycerol
|
| Preservative |
0.02% Sodium Azide
|
| Purity |
Immunogen affinity purified
|
Alternate Names for Integrin alpha 2b/CD41 Antibody
- CD41 antigen
- CD41
- CD41BHPA3
- GP2B
- GP2Bintegrin alpha-IIb
- GPalpha IIb
- GPIIb
- GTA
- HPA3
- Integrin alpha 2b
- integrin, alpha 2b (platelet glycoprotein IIb of IIb/IIIa complex, antigenCD41)
- integrin, alpha 2b (platelet glycoprotein IIb of IIb/IIIa complex, antigenCD41B)
- ITGA2b
- ITGAB
- platelet fibrinogen receptor, alpha subunit
- Platelet membrane glycoprotein IIb
- platelet-specific antigen BAK