Product: N-Desmethyl Clomipramine (D5 hydrochloride)
SAT2 Antibody Summary
| Immunogen |
This antibody was developed against a recombinant protein corresponding to amino acids:LRLIRELAEFEKLSDQVKISEEALRADGFGDNPFYHCLV
|
| Specificity |
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
|
| Isotype |
IgG
|
| Clonality |
Polyclonal
|
| Host |
Rabbit
|
| Gene |
SAT2
|
| Purity |
Immunogen affinity purified
|
| Innovators Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovators Reward
|
Applications/Dilutions
| Dilutions |
|
| Application Notes |
For IHC-Paraffin HIER pH6 retrieval is recommended.
|
Reactivity Notes
Mouse (87%), Rat (87%)
Packaging, Storage & Formulations
| Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
|
| Buffer |
PBS (pH 7.2) and 40% Glycerol
|
| Preservative |
0.02% Sodium Azide
|
| Purity |
Immunogen affinity purified
|
Alternate Names for SAT2 Antibody
- diamine N-acetyltransferase 2
- EC 2.3.1.57
- Polyamine N-acetyltransferase 2
- S
- Spermidine/spermine N(1)-acetyltransferase 2
- spermidine/spermine N1-acetyltransferase 2
- spermidine/spermine N1-acetyltransferase family member 2
- SSAT2diamine acetyltransferase 2
- Thialysine N-epsilon-acetyltransferase