Signal Peptide Peptidase Antibody

By PTKs RTKs July 26, 2017

Signal Peptide Peptidase Antibody Summary

Immunogen	The immunogen this antibody was made to, maps to a region between residue 327 to 377 of human Signal Peptide Peptidase Like 1 using the numbering given in entry NP_110416.1 (GeneID 81502).
Clonality	Polyclonal
Host	Rabbit
Gene	HM13
Purity	Immunogen affinity purified
Innovators Reward	Test in a species/application not listed above to receive a full credit towards a future purchase. Learn about the Innovators Reward

Dilutions

Storage	Store at 4C. Do not freeze.
Buffer	Tris-Citrate/Phosphate (pH 7.0 – 8.0)
Preservative	0.09% Sodium Azide
Concentration	1 mg/ml
Purity	Immunogen affinity purified

By PTKs RTKs July 26, 2017

Immunogen	This antibody was developed against Recombinant Protein corresponding to amino acids:PASFPNRQYQLLFTQGSGENKEEIINYEFDTKDLVCLGLSSIVGVWYLLRKHWIANNLFGLAFSLNGVELLHLNNVSTGC
Specificity	Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species	Mouse (98%), Rat (98%). Backed by our 100% Guarantee.
Isotype	IgG
Clonality	Polyclonal
Host	Rabbit
Gene	HM13
Purity	Immunogen affinity purified
Innovators Reward	Test in a species/application not listed above to receive a full credit towards a future purchase. Learn about the Innovators Reward

Dilutions

Application Notes

This product has been validated for use in IHC-Paraffin Embedded Tissues. HIER pH6 antigen retrieval is recommended.

Control Peptide

Signal Peptide Peptidase Protein (NBP1-92389PEP)

Storage	Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer	PBS (pH 7.2) and 40% Glycerol
Preservative	0.02% Sodium Azide
Purity	Immunogen affinity purified