ZFP37 Antibody

By PTKs RTKs July 26, 2017

ZFP37 Antibody Summary

Immunogen	ZFP37 (NP_003399.1, 1 a.a. – 630 a.a.) full-length human protein. MSVSSGVQILTKPETVDRRRSAETTKEAGRPLEMAVSEPEASAAEWKQLDPAQSNLYNDVMLENYCNQASMGCQAPKPDMISKLEKGEAPWLGKGKRPSQGCPSKIARPKQKETDGKVQKDDDQLENIQKSQNKLLREVAVKKKTQAKKNGSDCGSLGKKNNLHKKHVPSKKRLLKFESCGKILKQNLDLPDHSRNCVKRKSDAAKEHKKSFNHSLSDTRKGKKQTGKKHEKLSSHSSSDKCNKTGKKHDKLCCHSSSHIKQDKIQTGEKHEKSPSLSSSTKHEKPQACVKPYECNQCGKVLSHKQGLIDHQRVHTGEKPYECNECGIAFSQKSHLVVHQRTHTGEKPYECIQCGKAHGHKHALTDHLRIHTGEKPYECAECGKTFRHSSNLIQHVRSHTGEKPYECKECGKSFRYNSSLTEHVRTHTGEIPYECNECGKAFKYSSSLTKHMRIHTGEKPFECNECGKAFSKKSHLIIHQRTHTKEKPYKCNECGKAFGHSSSLTYHMRTHTGESPFECNQCGKGFKQIEGLTQHQRVHTGEKPYECNECGKAFSQKSHLIVHQRTHTGEKPYECNECEKAFNAKSQLVIHQRSHTGEKPYECNECGKTFKQNASLTKHVKTHSEDKSHE
Specificity	ZFP37 – zinc finger protein 37 homolog (mouse),
Clonality	Polyclonal
Host	Mouse
Gene	ZFP37
Purity	Protein A purified
Innovators Reward	Test in a species/application not listed above to receive a full credit towards a future purchase. Learn about the Innovators Reward

Dilutions	Western Blot Immunocytochemistry/Immunofluorescence
Application Notes	Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB and also on transfected lysate in WB. GST tag alone is used as a negative control. It has been used for IF.

Storage	Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer	PBS (pH 7.4)
Preservative	No Preservative
Purity	Protein A purified

Quality control test: Antibody reactive against mammalian transfected lysate.

This product is produced by and distributed for Abnova, a company based in Taiwan.

By PTKs RTKs July 26, 2017

Immunogen	This antibody was developed against Recombinant Protein corresponding to amino acids: MSVSSGDQILTKPETVDRRRSAETTKEAGRPLEMAVSEPEASAAEWKQLD P
Specificity	Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype	IgG
Clonality	Polyclonal
Host	Rabbit
Gene	ZFP37
Purity	Immunogen affinity purified
Innovators Reward	Test in a species/application not listed above to receive a full credit towards a future purchase. Learn about the Innovators Reward

Dilutions

Application Notes

This product has been validated for use in IHC-Paraffin Embedded Tissues. HIER pH6 antigen retrieval is recommended.

Control Peptide

ZFP37 Protein (NBP2-13546PEP)

Storage	Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer	PBS (pH 7.2) and 40% Glycerol
Preservative	0.02% Sodium Azide
Purity	Immunogen affinity purified