Product: Theophylline RGS16 Antibody Summary ImmunogenThis antibody was developed against a recombinant protein corresponding to amino acids:QASAASATLSSCSLDEPSHTSpecificitySpecificity of antibody verified on a Protein Array containing target protein plus 383 other…
Product: Solamargine ANKRD31 Antibody Summary ImmunogenThis antibody was developed against a recombinant protein corresponding to amino acids:CLTSAQRSSIDPLDIEDVYQHKKPKFSSKSHIWHVYNENSNRQKLEHVKVNKGSKASLFINKEDVYEYYQKDPKNTKFGKSKHKQSTLDQIYSTSpecificitySpecificity of antibody verified on a Protein Array containing target protein plus 383 other…
Product: Pinoresinol Diglucoside CD163 Antibody Summary ImmunogenThis antibody was developed against a recombinant protein corresponding to amino acids:ACKQLGCPTAVTAIGRVNASKGFGHIWLDSVSCQGHEPAVWQCKHHEWGKHYCNHNEDAGVTCSDSpecificitySpecificity of antibody verified on a Protein Array containing target protein plus 383…
Product: N-Desmethyl Clomipramine (D5 hydrochloride) SAT2 Antibody Summary ImmunogenThis antibody was developed against a recombinant protein corresponding to amino acids:LRLIRELAEFEKLSDQVKISEEALRADGFGDNPFYHCLVSpecificitySpecificity of antibody verified on a Protein Array containing target protein…
Product: Carvedilol metabolite 6-Hydroxyphenyl Carvedilol C2orf57 Antibody Summary ImmunogenThis antibody was developed against a recombinant protein corresponding to amino acids:SHLLGKDKMSQMASVPEREPESAPSAPSAELQSTQHMEAQPVESDADHVTAGANGQHGPQAASTTKSAEEKAEHPSpecificitySpecificity of antibody verified on a Protein Array containing target protein…
Product: Mebeverine metabolite Mebeverine acid C10orf71 Antibody Summary ImmunogenThis antibody was developed against a recombinant protein corresponding to amino acids:TASHINPQKDPTADPSEPSADSYLTLSTAPTIAKAPFYVNGEAAERSSYENKEVEGELEMGPAGSSWCPDSREHRPRKHLSLRLCNRDPEPGGSpecificitySpecificity of antibody verified on a Protein Array containing target protein…
Product: Mebeverine metabolite Mebeverine alcohol CARD11/CARMA1 Antibody Summary ImmunogenThis antibody was developed against a recombinant protein corresponding to amino acids:ELEEKNDEMRIEMVRREACIVNLESKLRRLSKDSNNLDQSLPRNLPVTIISQDFGDASPRTNGQEADDSSTSEESPEDSKYFLPYHPSpecificitySpecificity of antibody verified on a Protein Array containing target protein…
Product: Mebeverine metabolite O-desmethyl Mebeverine acid Doppel Antibody Summary ImmunogenThis antibody was developed against a recombinant protein corresponding to amino acids: GIKHRIKWNRKALPSTAQITEAQVAENRPGAFIKQGRKLDIDFGAEGNRYYEANYWQFSpecificitySpecificity of antibody verified on a Protein Array containing…
Product: Itraconazole metabolite Hydroxy Itraconazole TPSD1 Antibody Summary ImmunogenThis antibody was developed against a recombinant protein corresponding to amino acids: NVHLPPPYPLKEVEVPVVENHLCNAEYHTGLHTGHSFQIVRDSpecificitySpecificity of antibody verified on a Protein Array containing target…
Product: 5-Hydroxy Propafenone (D7 Hydrochloride) PDCL2 Antibody Summary ImmunogenThis antibody was developed against Recombinant Protein corresponding to amino acids: PPKEESKDEIEEMVLRLQKEAMVKPFEKMTLAQLKEAEDEFDEEDMQAVE TYRKKRLQEWKALSpecificitySpecificity of antibody verified on a Protein Array containing target…