ZNF662 Antibody

Product: Ivabradine metabolite N-Demethyl Ivabradine (hydrochloride) ZNF662 Antibody Summary ImmunogenThis antibody was developed against a recombinant protein corresponding to amino acids: TPWCSVPRGALDGEAPRGISSGYPFLKPAGISHPEQVEEPLNLKLQGEGPSLICPEGVLKRKKEDFILKEEIIEEAQDLMVLSSGPQWCGSpecificitySpecificity of antibody verified on a Protein Array containing…

PIGA Antibody

Product: N-Demethyl Ivabradine (D8 Hydrochloride) PIGA Antibody Summary ImmunogenThis antibody was developed against Recombinant Protein corresponding to amino acids: FADVSSVLTNKLLTVSLCDTNHIICVSYTSKENTVLRAALNPEIVSVIPN AVDPTDFTPDPFRRHDSITIVVVSRLVYRKGIDLLSGIIPELCQKYPDLN FIIGGEGPKRIISpecificitySpecificity of antibody verified on a Protein Array containing…

ATG9A Antibody

Product: 6-beta-Naloxol (D7 hydrochloride) ATG9A Antibody Summary ImmunogenThis antibody was developed against a recombinant protein corresponding to amino acids: IYNICCYWEIHSFYLHALRIPMSALPYCTWQEVQARIVQTQKEHQICIHKRELTELDSpecificitySpecificity of antibody verified on a Protein Array containing target protein…

PLCL2 Antibody

Product: Bendamustine D6 PLCL2 Antibody Summary ImmunogenThis antibody was developed against Recombinant Protein corresponding to amino acids: DMLESSQDNMRTSWVSQMFSEIDVDNLGHITLCNAVQCIRNLNPGLKTSK IELKFKELHKSKDKAGTEVTKEEFIESpecificitySpecificity of antibody verified on a Protein Array containing target protein plus…

ACBD7 Antibody

Product: Rasagiline 13C5 (mesylate racemic) ACBD7 Antibody Summary ImmunogenThis antibody was developed against a recombinant protein corresponding to amino acids: DVRKLKARPDDGELKELYGLYKQAIVGDSpecificitySpecificity of antibody verified on a Protein Array containing target…

TMEM90A Antibody

Product: Sofosbuvir 13CD5 TMEM90A Antibody Summary ImmunogenThis antibody was developed against a recombinant protein corresponding to amino acids: ESLSELQNPLLPRSPAHLHGPYPYPETPPSWSCQEKLYSYLLGGAGPAGAHQLLDPGSLQLAVEAWYRPSCLLGRDKVKESpecificitySpecificity of antibody verified on a Protein Array containing target protein plus…

TMEM107 Antibody

Product: PSI-6206 13CD5 TMEM107 Antibody Summary ImmunogenThis antibody was developed against a recombinant protein corresponding to amino acids: SGVSMFNSTQSLISIGAHCSASVSpecificitySpecificity of antibody verified on a Protein Array containing target protein plus…

CWH43 Antibody

Product: Methylnaltrexone D5 (Bromide) CWH43 Antibody Summary ImmunogenThis antibody was developed against a recombinant protein corresponding to amino acids: GNVKDIDSTDHDRWCEYIMYRGLIRLGYARISHAELSDSEIQMAKFRIPDDPTNYRDNQKVVIDHREVSEKIHFNPRFGSYKEGHNYENNHHFHMNTPKYFSpecificitySpecificity of antibody verified on a Protein Array containing target protein…

BCAM/CD239 Antibody

Product: Rotigotine (D9 Hydrochloride) BCAM/CD239 Antibody Summary ImmunogenThis antibody was developed against a recombinant protein corresponding to amino acids: EVLNVNLEGNLTLEGVTRGQSGTYGCRVEDYDAADDVQLSKTLELRVAYLDPLELSEGKVLSLPLNSSAVVNCSVHGLPTPALRWTKDSTPLGDGPMLSLSSITFDSNGTYVCEASLPTVPVLSRTQNFTLLVQSpecificitySpecificity of antibody verified on a Protein Array containing target protein…

CKAP2 Antibody

Product: Perphenazine (D10 Dihydrochloride) CKAP2 Antibody Summary ImmunogenThis antibody was developed against Recombinant Protein corresponding to amino acids:VKYWICLALIEPITSPIENIIAIYEKAILAGAQPIEEMRHTIVDILTMKSQEKANLGENMEKSCASKEEVKEVSIEDTGVDVDPEKLEMESKLHRNLLFQDCEKEQDNKTKDPTHSpecificitySpecificity of antibody verified on a Protein Array containing target protein plus 383…