Product: SAG ATF7IP2 Antibody Summary ImmunogenThis antibody was developed against Recombinant Protein corresponding to amino acids:SVESPNLTTPITSNPTDTRKITSGNSSNSPNAEVMAVQKKLDSIIDLTKEGLSNCNTESPVSPLESHSKAASNSKETTPLAQNAVQVPESFEHLPPLPEPPAPLSpecificitySpecificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific…
Product: GSK505 ZNF334 Antibody Summary ImmunogenThis antibody was developed against Recombinant Protein corresponding to amino acids: HTGEKHGVFNKCGRISIVKSNCSQCKRMNTKENLYECSEHGHAVSKNSHL IVHQSpecificitySpecificity of antibody verified on a Protein Array containing target protein plus 383…
Product: APY0203 KRT78 Antibody Summary ImmunogenThis antibody was developed against Recombinant Protein corresponding to amino acids:VGGGLGSTCGLGSGKGSPGSCCTSIVTGGSNIILGSGKDPVLDSCSVSGSSSpecificitySpecificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific…
Product: PFI-4 Syntaphilin Antibody Summary ImmunogenThis antibody was developed against Recombinant Protein corresponding to amino acids: FPASNTYEKLLCGMEAGVQASCMQERAIQTDFVQYQPDLDTILEKVTQAQ VCGTDPESGDRCPELDAHPSGPRDPNSAVVVSpecificitySpecificity of antibody verified on a Protein Array containing target protein plus 383…
Product: PFI-4 (hydrochloride) ZFP37 Antibody Summary ImmunogenThis antibody was developed against Recombinant Protein corresponding to amino acids: MSVSSGDQILTKPETVDRRRSAETTKEAGRPLEMAVSEPEASAAEWKQLD PSpecificitySpecificity of antibody verified on a Protein Array containing target protein plus…
Product: Nucleoside-Analog-3 IWS1 Antibody Summary ImmunogenThis antibody was developed against Recombinant Protein corresponding to amino acids:IFGESGDEEEEEFTGFNQEDLEEEKGETQVKEAEDSDSDDNIKRGKHMDFLSDFEMMLQRKKSMSGKRRRNRDGGTFISDADDVVSAMIVKMNEAASpecificitySpecificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific…
Product: Nucleoside-Analog-4 GABA Receptor Epsilon Antibody Summary ImmunogenThis antibody was developed against Recombinant Protein corresponding to amino acids:PQTESKNEASSRDVVYGPQPQPLENQLLSEETKSTETETGSRVGKLPEASRILNTILSNYDHKLRPGIGEKPTVVTVEIAVNSLGPLSpecificitySpecificity of antibody verified on a Protein Array containing target protein plus 383…
Product: Pivmecillinam TRIM43 Antibody Summary ImmunogenThis antibody was developed against Recombinant Protein corresponding to amino acids:QHLERLNKEYQEIFQQLQRSWVKMDQKSKHLKEMYQELMEMCSpecificitySpecificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific…
Product: Ginsenoside Rb4 LSM8 Antibody Summary ImmunogenThis antibody was developed against Recombinant Protein corresponding to amino acids:ALENYINRTVAVITSDGRMIVGTLKGFDQTINLILDESHERVFSSSQGVEQVVLGLYIVRGDNVAVIGEIDEETDSALDLGNIRAEPSpecificitySpecificity of antibody verified on a Protein Array containing target protein plus 383 other…
Product: Ginsenoside Rb5 Signal Peptide Peptidase Antibody Summary ImmunogenThis antibody was developed against Recombinant Protein corresponding to amino acids:PASFPNRQYQLLFTQGSGENKEEIINYEFDTKDLVCLGLSSIVGVWYLLRKHWIANNLFGLAFSLNGVELLHLNNVSTGCSpecificitySpecificity of antibody verified on a Protein Array containing target protein plus…