Product: Cevipabulin SNX26 Antibody Summary ImmunogenThis antibody was developed against Recombinant Protein corresponding to amino acids:PSECVELFTERPGPGLKADADGPPCGIPAPQGISSLTSAVPRPRGKLAGLLRTFMRSRPSRQRLRQRGILSpecificitySpecificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific…
Product: GSK2803 RAB19B Antibody Summary ImmunogenThis antibody was developed against Recombinant Protein corresponding to amino acids: LIGNKCDLWEKRHVLFEDACTLAEKYGLLAVLETSAKESSpecificitySpecificity of antibody verified on a Protein Array containing target protein plus 383 other…
Product: 5(8)-FAM SE SLC26A10 Antibody Summary ImmunogenThis antibody was developed against Recombinant Protein corresponding to amino acids:FGTRGQFRCNLEWHLGLGEGEKETSKPDGPMVAVAEPVRVVVLDFSGVTFADAAGAREVVQSpecificitySpecificity of antibody verified on a Protein Array containing target protein plus 383 other…
Product: 5(8)-FITC KRTAP22-1 Antibody Summary ImmunogenThis antibody was developed against Recombinant Protein corresponding to amino acids:LGCSYGCGHSGYGYACYCPWCYERSWFSpecificitySpecificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific…
Product: 5(8)-TAMRA MFSD7 Antibody Summary ImmunogenThis antibody was developed against Recombinant Protein corresponding to amino acids:TALTVRRSEPSLSTCQQGEDPLDWTSpecificitySpecificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific…
Product: AZD1983 ZNF406 Antibody Summary ImmunogenThis antibody was developed against Recombinant Protein corresponding to amino acids: EPGGDIQQEALGDQLQLVEEEFALQGVNALKEEACPGDTQLEEGRKEPEA PGEMPAPAVHLASPQAESTALPPCELETTSpecificitySpecificity of antibody verified on a Protein Array containing target protein plus 383…
Product: Sal005 DIRAS3 Antibody Summary ImmunogenThis antibody was developed against Recombinant Protein corresponding to amino acids:YCQLLGCSHGVLSLHITDSKSGDGNRALQRHVIARGHAFVLVYSVTKKETLEELKAFYELICKIKGNNLHKFSpecificitySpecificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific…
Product: BNC107 mGluR1 Antibody Summary ImmunogenThis antibody was developed against Recombinant Protein corresponding to amino acids:PKGQHMWHRLSVHVKTNETACNQTAVIKPLTKSYQGSGKSLTFSDTSTKTLYNVEEEEDAQPIRFSPPGSPSMVVHRRVPSAATTPPLPSHLTAEETPLFLAEPALPKGLPPPLQQQQQPPPQQKSLMDQSpecificitySpecificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific…
Product: Scopine (hydrochloride) LIX1L Antibody Summary ImmunogenThis antibody was developed against Recombinant Protein corresponding to amino acids:LKAMRERQCSRQEVLAHYSHRALDDDIRHQMALDWVSREQSVPGALSRELASTERELDEARLAGKELRFHKSpecificitySpecificity of antibody verified on a Protein Array containing target protein plus 383 other…
Product: Terbutaline (sulfate) Kir3.1 Antibody Summary ImmunogenThis antibody was developed against Recombinant Protein corresponding to amino acids:VPTPPYSVKEQEEMLLMSSPLIAPAITNSKERHNSVECLDGLDDITTKLPSKLQKITGREDFPKKLLRMSSTTSEKAYSLGDLPMKLQRISSVPGNSEEKLVSKTTKMLSDPMSQSVADLPPKLQKMAGGAARMEGNSpecificitySpecificity of antibody verified on a Protein Array containing target protein plus 383 other…