CKS2 Antibody

Product: MK2-IN-3 CKS2 Antibody Summary ImmunogenThis antibody was developed against a recombinant protein corresponding to the following amino acid sequence:HKQIYYSDKYFDEHYEYRHVMLPRELSKQVPKTHLMSEEEWRRLGVQQSLGWVHYMIHEPEPHILLFRRPLPKDQQSpecificitySpecificity of antibody verified on a Protein Array containing target protein…

ZNF629 Antibody

Product: S1P3 Agonist III ZNF629 Antibody Summary ImmunogenThis antibody was developed against a recombinant protein corresponding to the following amino acid sequence:MEPETALWGPDLQGPEQSPNDAHRGAESENEEESPRQESSGEEIIMGDPAQSPESKDSTEMSLERSSQDSpecificitySpecificity of antibody verified on a Protein Array containing…

MSTO1 Antibody

Product: IFN alpha-IFNAR-IN-3 MSTO1 Antibody Summary ImmunogenThis antibody was developed against a recombinant protein corresponding to amino acids: DRACHTSQLTPGTPPPSALHACTTGEEILAQYLQQQQPGVMSSSHLLLTPCRVAPPYPHLFSSCSPPGMVLDGSPKGAAVESIPVFGALCSSSSLHQTLEALARDLTKLDLRRWASFMDAGVEHDDVAELLQELQSLAQCYQGGDSLVDSpecificitySpecificity of antibody verified on a Protein Array containing target protein plus…

DPEP3 Antibody

Product: EN462 DPEP3 Antibody Summary ImmunogenThis antibody was developed against a recombinant protein corresponding to amino acids: PRALSTLGSPSLFTTPGVPSALTTPGLTTPGTPKTLDLRGRAQALMRSFPLSpecificitySpecificity of antibody verified on a Protein Array containing target protein plus 383…

RASL10A Antibody

Product: Mirk-IN-3 RASL10A Antibody Summary ImmunogenThis antibody was developed against a recombinant protein corresponding to amino acids: AKYNWHVLRLFRELLRCALVRARPAHPALRLQGALHPARCSLMSpecificitySpecificity of antibody verified on a Protein Array containing target protein plus 383…

NT5DC4 Antibody

Product: p38 MAPK-IN-3 NT5DC4 Antibody Summary ImmunogenThis antibody was developed against Recombinant Protein corresponding to amino acids: RLEELKRLDTHLADIYQHMDGSSCELQVINFTKREIQMPHESVVEQEQAN LDPASCLLSCNQRSLPAKSCLSSAISpecificitySpecificity of antibody verified on a Protein Array containing target protein plus…

MRPL48 Antibody

Product: OBA-11 MRPL48 Antibody Summary ImmunogenThis antibody was developed against a recombinant protein corresponding to amino acids: IKVEESYAMPTKTIEVLQLQDQGSKMLLDSVLTTHERVVQISGLSATFAEIFLEIIQSSLPEGVRLSVKEHTEEDFKGRFKARPELEELLSpecificitySpecificity of antibody verified on a Protein Array containing target protein plus 383…

ZFYVE21 Antibody

Product: UC-114 ZFYVE21 Antibody Summary ImmunogenThis antibody was developed against a recombinant protein corresponding to amino acids: SGATFLVTFGNSEKPETMTCRLSNNQRYLFLDGDSHYEIEIVHISTVQILTEGFPPGGGNARATGMFLQYTVPGSpecificitySpecificity of antibody verified on a Protein Array containing target protein plus 383…

ELL Antibody

Product: Dinoprost ELL Antibody Summary ImmunogenThis antibody was developed against Recombinant Protein corresponding to amino acids: ANMSAKDGTCTLQDCMYKDVQKDWPGYSEGDQQLLKRVLVRKLCQPQSTG SLLGDPAASSPPGERGRSASPPQKRLQPPDFIDPLANKKPRISHFTQRAQ PAVNGKLGSpecificitySpecificity of antibody verified on a Protein Array containing target protein plus…

NHSL2 Antibody

Product: Dinoprost (tromethamine salt) NHSL2 Antibody Summary ImmunogenThis antibody was developed against a recombinant protein corresponding to amino acids: TSPMEKFPKSRLSFDLPLTSSPNLDLSGMSISIRSKTKVSRHHSETNFGVKLAQKTNPNQPIMPMVTQSDLRSVRLRSVSKSEPEDDSpecificitySpecificity of antibody verified on a Protein Array containing target protein…