Product: SB 242086 ZNF585B Antibody Summary ImmunogenThis antibody was developed against a recombinant protein corresponding to the following amino acid sequence:CAEFGKSFTWKSQFKASQNSYRRSpecificitySpecificity of antibody verified on a Protein Array containing target…
Product: SB 242086 (hydrochloride) PLEKHG3 Antibody Summary ImmunogenThis antibody was developed against a recombinant protein corresponding to the following amino acid sequence:DSLSCQLSPEVDISVGVATEDSPSVNGMEPPSPGCPVEPDRSSCKKKESALSTRDRLLLDKIKSYYENAEHHDSpecificitySpecificity of antibody verified on a Protein Array containing…
Product: Motolimod IL-33 Antibody Summary ImmunogenThis antibody was developed against a recombinant protein corresponding to the following amino acid sequence:MVTLSPTKDFWLHANNKEHSVELHKCEKPLPDQAFFVLHNMHSNCVSFECKTDPGVFIGVKDNHLALIKVDSSENLCTENILFKLSpecificitySpecificity of antibody verified on a Protein Array containing target protein…
Product: TVP1024 (mesylate) ARL4 Antibody Summary ImmunogenThis antibody was developed against a recombinant protein corresponding to the following amino acid sequence:MGNGLSDQTSILSNLPSFQSFHIVILGLDCSpecificitySpecificity of antibody verified on a Protein Array containing target…
Product: Chembridge-5861530 ITF46 Antibody Summary ImmunogenThis antibody was developed against a recombinant protein corresponding to the following amino acid sequence:LDEPSTKQSDPTVLSLWLTENSKQHNITQHMKVKSLEDAEKNPKAIDTWIESISELHRSKPPATVHYTRPMPDIDTLMQEWSPEFSpecificitySpecificity of antibody verified on a Protein Array containing target protein…
Product: Piboserod PCDHGB1 Antibody Summary ImmunogenThis antibody was developed against a recombinant protein corresponding to the following amino acid sequence:(INAEITYAFLNSPISTSLFNLNPNTGDITTNGTLDFEETSRYVLSVEAKDG,)SpecificitySpecificity of antibody verified on a Protein Array containing target protein…
Product: Piboserod (hydrochloride) LINC00493 Antibody Summary ImmunogenThis antibody was developed against a recombinant protein corresponding to the following amino acid sequence:SLLYYSRTMAKSSVDQKDGSASEVPSELSERPKGFYVETVVTYKEDFVPNTEKILNYWKSWTGGPGTEPSpecificitySpecificity of antibody verified on a Protein Array containing target…
Product: Lemborexant HIC2 Antibody Summary ImmunogenThis antibody was developed against a recombinant protein corresponding to the following amino acid sequence:VIQARYQGLVDGRKGAHAPQELPQAKGSDDELFLGGSNQDSVQGLGRAVCPAGGEAGLGGCSSSTNGSSGGCEQELGLDSpecificitySpecificity of antibody verified on a Protein Array containing target protein…
Product: T338C Src-IN-3 Afadin/AF-6 Antibody Summary ImmunogenThis antibody was developed against a recombinant protein corresponding to the following amino acid sequence:DDRPFQGEDVENSRLAAEVYKDMPETSFTRTISNPEVVMKRRRQQKLEKRMQEFRSSDGRPDSSpecificitySpecificity of antibody verified on a Protein Array containing target…
Product: T338C Src-IN-4 MTIF2 Antibody Summary ImmunogenThis antibody was developed against a recombinant protein corresponding to the following amino acid sequence:ELLAYDVVCEDYGGDVQAVPVSALTGDNLMALAEATVALAEMLELKADPNGPVEGTVIESFTDKGRGLVTTAIIQRGTLRKGSVLVAGKCWAKVSpecificitySpecificity of antibody verified on a Protein Array containing target…